ACVRL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119574
Article Name: ACVRL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119574
Supplier Catalog Number: orb2119574
Alternative Catalog Number: BYT-ORB2119574-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACVRL1
Conjugation: HRP
Alternative Names: HHT, ALK1, HHT2, ORW2, SKR3, ALK-1, TSR-I, ACVRLK1
ACVRL1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 000011
UniProt: P37023
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH