ACVRL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119576
Article Name: ACVRL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119576
Supplier Catalog Number: orb2119576
Alternative Catalog Number: BYT-ORB2119576-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACVRL1
Conjugation: Biotin
Alternative Names: HHT, ALK1, HHT2, ORW2, SKR3, ALK-1, TSR-I, ACVRLK1
ACVRL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 000011
UniProt: P37023
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH