NAT2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119577
Article Name: NAT2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119577
Supplier Catalog Number: orb2119577
Alternative Catalog Number: BYT-ORB2119577-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAT2
Conjugation: HRP
Alternative Names: AAC2, PNAT, NAT-2
NAT2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 000006
UniProt: P11245
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT