SLC16A12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119592
Article Name: SLC16A12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119592
Supplier Catalog Number: orb2119592
Alternative Catalog Number: BYT-ORB2119592-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC16A12
Conjugation: HRP
Alternative Names: CJMG, CRT2, MCT12, CTRCT47
SLC16A12 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 998771
UniProt: Q6ZSM3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT