SLC25A35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119599
Article Name: SLC25A35 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119599
Supplier Catalog Number: orb2119599
Alternative Catalog Number: BYT-ORB2119599-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A35
Conjugation: FITC
Alternative Names: SLC25A35,
SLC25A35 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 005256696
UniProt: Q3KQZ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST