SLC26A5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119604
Article Name: SLC26A5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119604
Supplier Catalog Number: orb2119604
Alternative Catalog Number: BYT-ORB2119604-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A5
Conjugation: HRP
Alternative Names: PRES, DFNB61
SLC26A5 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 945350
UniProt: P58743
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS