Slc37a2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119607
Article Name: Slc37a2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119607
Supplier Catalog Number: orb2119607
Alternative Catalog Number: BYT-ORB2119607-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: HRP
Alternative Names: G3, ci, cI-, ci2, G3PP, Slc3, cI-2, Slc37a1
Slc37a2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 064654
UniProt: Q9WU81
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI