Slc37a2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119609
Article Name: Slc37a2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119609
Supplier Catalog Number: orb2119609
Alternative Catalog Number: BYT-ORB2119609-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: G3, ci, cI-, ci2, G3PP, Slc3, cI-2, Slc37a1
Slc37a2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 064654
UniProt: Q9WU81
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI