SLC19A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119611
Article Name: SLC19A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119611
Supplier Catalog Number: orb2119611
Alternative Catalog Number: BYT-ORB2119611-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
Conjugation: FITC
Alternative Names: RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1
SLC19A1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 919231
UniProt: P41440
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP