SLC35E2A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119613
Article Name: SLC35E2A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119613
Supplier Catalog Number: orb2119613
Alternative Catalog Number: BYT-ORB2119613-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC35E2
Conjugation: HRP
Alternative Names: SLC35E2
SLC35E2A Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 878258
UniProt: Q5CZA4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP