Slc6a15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2119621
| Article Name: |
Slc6a15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2119621 |
| Supplier Catalog Number: |
orb2119621 |
| Alternative Catalog Number: |
BYT-ORB2119621-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Biotin |
| Alternative Names: |
v7-, v7-3, AA536730, AI326450, AI326451 |
| Slc6a15 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
82kDa |
| NCBI: |
780537 |
| UniProt: |
Q8BG16 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA |
