SLC36A2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119629
Article Name: SLC36A2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119629
Supplier Catalog Number: orb2119629
Alternative Catalog Number: BYT-ORB2119629-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC36A2
Conjugation: FITC
Alternative Names: PAT2, TRAMD1
SLC36A2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 861441
UniProt: Q495M3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL