SLC41A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119642
Article Name: SLC41A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119642
Supplier Catalog Number: orb2119642
Alternative Catalog Number: BYT-ORB2119642-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A1
Conjugation: Biotin
Alternative Names: MgtE
SLC41A1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 776253
UniProt: Q8IVJ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP