SLC39A5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119653
Article Name: SLC39A5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119653
Supplier Catalog Number: orb2119653
Alternative Catalog Number: BYT-ORB2119653-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5
Conjugation: FITC
Alternative Names: ZIP5, MYP24, LZT-Hs7
SLC39A5 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 775867
UniProt: Q6ZMH5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG