SLC35F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119659
Article Name: SLC35F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119659
Supplier Catalog Number: orb2119659
Alternative Catalog Number: BYT-ORB2119659-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC35F3
Conjugation: FITC
Alternative Names: FLJ37712
SLC35F3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 775779
UniProt: Q8IY50
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW