SLCO6A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119664
Article Name: SLCO6A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119664
Supplier Catalog Number: orb2119664
Alternative Catalog Number: BYT-ORB2119664-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO6A1
Conjugation: HRP
Alternative Names: GST, CT48, OATPY, OATP-I, OATP6A1
SLCO6A1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 775759
UniProt: Q86UG4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS