SLC25A26 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119668
Article Name: SLC25A26 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119668
Supplier Catalog Number: orb2119668
Alternative Catalog Number: BYT-ORB2119668-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC25A26
Conjugation: FITC
Alternative Names: SAMC, COXPD28
SLC25A26 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 775742
UniProt: Q70HW3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGSFPNAAAFFI