SLC25A16 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2119680
| Article Name: |
SLC25A16 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2119680 |
| Supplier Catalog Number: |
orb2119680 |
| Alternative Catalog Number: |
BYT-ORB2119680-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A16 |
| Conjugation: |
FITC |
| Alternative Names: |
GDA, GDC, ML7, hML7, HGT.1, D10S105E |
| SLC25A16 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
36kDa |
| NCBI: |
689920 |
| UniProt: |
P16260 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM |
