SLC2A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119711
Article Name: SLC2A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119711
Supplier Catalog Number: orb2119711
Alternative Catalog Number: BYT-ORB2119711-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A12
Conjugation: Biotin
Alternative Names: GLUT8, GLUT12
SLC2A12 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 660159
UniProt: Q8TD20
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL