SLC35A4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119732
Article Name: SLC35A4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119732
Supplier Catalog Number: orb2119732
Alternative Catalog Number: BYT-ORB2119732-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC35A4
Conjugation: Biotin
Alternative Names: MGC2541
SLC35A4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 542401
UniProt: Q96G79
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL