SLC2A13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119756
Article Name: SLC2A13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119756
Supplier Catalog Number: orb2119756
Alternative Catalog Number: BYT-ORB2119756-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A13
Conjugation: Biotin
Alternative Names: HMIT
SLC2A13 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 443117
UniProt: Q96QE2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNEC