SLC39A10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119876
Article Name: SLC39A10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119876
Supplier Catalog Number: orb2119876
Alternative Catalog Number: BYT-ORB2119876-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC39A10
Conjugation: Biotin
Alternative Names: LZT-Hs2
SLC39A10 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 065075
UniProt: Q9ULF5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDP