SLCO2B1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120015
Article Name: SLCO2B1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120015
Supplier Catalog Number: orb2120015
Alternative Catalog Number: BYT-ORB2120015-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
Conjugation: HRP
Alternative Names: OATPB, OATP-B, OATP2B1, SLC21A9
SLCO2B1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 009187
UniProt: O94956
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ