SLCO2B1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120016
Article Name: SLCO2B1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120016
Supplier Catalog Number: orb2120016
Alternative Catalog Number: BYT-ORB2120016-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
Conjugation: FITC
Alternative Names: OATPB, OATP-B, OATP2B1, SLC21A9
SLCO2B1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 009187
UniProt: O94956
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ