SLCO1A2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120042
Article Name: SLCO1A2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120042
Supplier Catalog Number: orb2120042
Alternative Catalog Number: BYT-ORB2120042-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2
Conjugation: HRP
Alternative Names: OATP, OATP-A, OATP1A2, SLC21A3
SLCO1A2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 52694
UniProt: P46721
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK