TAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2120431
| Article Name: |
TAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2120431 |
| Supplier Catalog Number: |
orb2120431 |
| Alternative Catalog Number: |
BYT-ORB2120431-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TAP1 |
| Conjugation: |
Biotin |
| Alternative Names: |
APT1, PSF1, ABC17, ABCB2, PSF-1, RING4, TAP1N, D6S114E, TAP1*0102N |
| TAP1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
87kDa |
| NCBI: |
000584 |
| UniProt: |
Q03518 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
