CREBBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120455
Article Name: CREBBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120455
Supplier Catalog Number: orb2120455
Alternative Catalog Number: BYT-ORB2120455-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREBBP
Conjugation: Biotin
Alternative Names: CBP, RSTS, KAT3A, MKHK1, RSTS1
CREBBP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 261kDa
NCBI: 001073315
UniProt: Q4LE28
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS