Gcdh Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120515
Article Name: Gcdh Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120515
Supplier Catalog Number: orb2120515
Alternative Catalog Number: BYT-ORB2120515-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: Biotin
Alternative Names: Gcdh
Gcdh Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 001102366
UniProt: D3ZT90
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV