AADAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120575
Article Name: AADAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120575
Supplier Catalog Number: orb2120575
Alternative Catalog Number: BYT-ORB2120575-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AADAT
Conjugation: Biotin
Alternative Names: KAT2, KATII, KYAT2
AADAT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 057312
UniProt: Q8N5Z0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI