PCSK5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120578
Article Name: PCSK5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120578
Supplier Catalog Number: orb2120578
Alternative Catalog Number: BYT-ORB2120578-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCSK5
Conjugation: Biotin
Alternative Names: PC5, PC6, PC6A, SPC6
PCSK5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 89kDa
NCBI: 006191
UniProt: Q92824
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS