GCNT3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120584
Article Name: GCNT3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120584
Supplier Catalog Number: orb2120584
Alternative Catalog Number: BYT-ORB2120584-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT3
Conjugation: Biotin
Alternative Names: GNTM, C24GNT, C2GNT2, C2GNTM, C2/4GnT
GCNT3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 004742
UniProt: O95395
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL