TRIM49B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120614
Article Name: TRIM49B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120614
Supplier Catalog Number: orb2120614
Alternative Catalog Number: BYT-ORB2120614-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TR49B
Conjugation: Biotin
Alternative Names: RNF18B
TRIM49B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 001193555
UniProt: A6NDI0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CPIESAAEEHQEKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRL