TRIM59 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120696
Article Name: TRIM59 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120696
Supplier Catalog Number: orb2120696
Alternative Catalog Number: BYT-ORB2120696-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM59
Conjugation: HRP
Alternative Names: MRF1, TSBF1, IFT80L, RNF104, TRIM57
TRIM59 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 775107
UniProt: Q8IWR1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH