RNF39 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120703
Article Name: RNF39 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120703
Supplier Catalog Number: orb2120703
Alternative Catalog Number: BYT-ORB2120703-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF39
Conjugation: FITC
Alternative Names: HZF, HZFW, LIRF, FAP216
RNF39 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 739576
UniProt: A6NCD6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL