RNF182 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120708
Article Name: RNF182 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120708
Supplier Catalog Number: orb2120708
Alternative Catalog Number: BYT-ORB2120708-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF182
Conjugation: HRP
Alternative Names: FLJ40772, MGC33993
RNF182 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 689950
UniProt: Q8N6D2
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY