TRIM60 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2120720
| Article Name: |
TRIM60 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2120720 |
| Supplier Catalog Number: |
orb2120720 |
| Alternative Catalog Number: |
BYT-ORB2120720-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM60 |
| Conjugation: |
HRP |
| Alternative Names: |
RNF33, RNF129 |
| TRIM60 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
55kDa |
| NCBI: |
689833 |
| UniProt: |
Q495X7 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF |
