TRIM60 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120721
Article Name: TRIM60 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120721
Supplier Catalog Number: orb2120721
Alternative Catalog Number: BYT-ORB2120721-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM60
Conjugation: FITC
Alternative Names: RNF33, RNF129
TRIM60 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 689833
UniProt: Q495X7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF