RNF168 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120723
Article Name: RNF168 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120723
Supplier Catalog Number: orb2120723
Alternative Catalog Number: BYT-ORB2120723-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF168
Conjugation: HRP
Alternative Names: RIDL, hRNF168
RNF168 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 689830
UniProt: Q8IYW5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA