LONRF1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120754
Article Name: LONRF1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120754
Supplier Catalog Number: orb2120754
Alternative Catalog Number: BYT-ORB2120754-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LONRF1
Conjugation: FITC
Alternative Names: RNF191
LONRF1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 005273742
UniProt: Q17RB8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SMPEREENLQAAPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQ