NSMCE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120767
Article Name: NSMCE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120767
Supplier Catalog Number: orb2120767
Alternative Catalog Number: BYT-ORB2120767-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NSMCE1
Conjugation: Biotin
Alternative Names: NSE1
NSMCE1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 659547
UniProt: Q8WV22
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL