MARCH8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120774
Article Name: MARCH8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120774
Supplier Catalog Number: orb2120774
Alternative Catalog Number: BYT-ORB2120774-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARCH8
Conjugation: HRP
Alternative Names: MIR, CMIR, c-MIR, MARCH8, RNF178, MARCH-VIII
MARCH8 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 659458
UniProt: Q5T0T0
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG