MARCH8 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120775
Article Name: MARCH8 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120775
Supplier Catalog Number: orb2120775
Alternative Catalog Number: BYT-ORB2120775-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARCH8
Conjugation: FITC
Alternative Names: MIR, CMIR, c-MIR, MARCH8, RNF178, MARCH-VIII
MARCH8 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 659458
UniProt: Q5T0T0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG