RNF133 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120778
Article Name: RNF133 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120778
Supplier Catalog Number: orb2120778
Alternative Catalog Number: BYT-ORB2120778-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF133
Conjugation: FITC
Alternative Names: MGC27072
RNF133 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 631914
UniProt: Q8WVZ7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA