RSPRY1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120786
Article Name: RSPRY1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120786
Supplier Catalog Number: orb2120786
Alternative Catalog Number: BYT-ORB2120786-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RSPRY1
Conjugation: HRP
Alternative Names: SEMDFA
RSPRY1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 588609
UniProt: Q96DX4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY