FBXW11 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120796
Article Name: FBXW11 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120796
Supplier Catalog Number: orb2120796
Alternative Catalog Number: BYT-ORB2120796-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXW11
Conjugation: FITC
Alternative Names: Hos, BTRC2, FBW1B, Fbw11, BTRCP2, FBXW1B, NEDJED
FBXW11 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 387448
UniProt: Q9UKB1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP