PCGF1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120816
Article Name: PCGF1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120816
Supplier Catalog Number: orb2120816
Alternative Catalog Number: BYT-ORB2120816-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCGF1
Conjugation: HRP
Alternative Names: NSPC1, RNF68, RNF3A-2, 2010002K04Rik
PCGF1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 116062
UniProt: Q9BSM1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV