LNX1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120819
Article Name: LNX1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120819
Supplier Catalog Number: orb2120819
Alternative Catalog Number: BYT-ORB2120819-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LNX1
Conjugation: HRP
Alternative Names: LNX, MPDZ, PDZRN2
LNX1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 116011
UniProt: Q8TBB1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA