TRIM63 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2120823
Article Name: TRIM63 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120823
Supplier Catalog Number: orb2120823
Alternative Catalog Number: BYT-ORB2120823-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM63
Conjugation: FITC
Alternative Names: IRF, SMRZ, MURF1, MURF2, RNF28
TRIM63 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 115977
UniProt: Q969Q1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ