TRIM63 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120827
Article Name: TRIM63 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120827
Supplier Catalog Number: orb2120827
Alternative Catalog Number: BYT-ORB2120827-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRIM63
Conjugation: Biotin
Alternative Names: IRF, SMRZ, MURF1, MURF2, RNF28
TRIM63 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 115977
UniProt: Q969Q1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQ