SYVN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120831
Article Name: SYVN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120831
Supplier Catalog Number: orb2120831
Alternative Catalog Number: BYT-ORB2120831-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SYVN1
Conjugation: HRP
Alternative Names: DER3, HRD1
SYVN1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 115807
UniProt: Q86TM6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV